Rabbit ICA1 antibody
-
Catalog number70R-3830
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenICA1 antibody was raised using the C terminal of ICA1 corresponding to a region with amino acids NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA
-
SpecificityICA1 antibody was raised against the C terminal of ICA1
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ICA1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolICA1-AS1, ICA1
-
Short nameRabbit ICA1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ICA1 antibody raised against the C terminal of ICA1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetislet cell autoantigen 1, 69kDa, ICA69 and ICAp69, ICA1 and IDBG-8551 and ENSG00000003147 and 3382, protein domain specific binding, Cell surfaces, Ica1 and IDBG-128452 and ENSMUSG00000062995 and 15893, BT.35115 and IDBG-629525 and ENSBTAG00000000799 and 535346
-
Gene info
-
Identity
-
Gene
-
Long gene nameICA1 antisense RNA 1
-
Locus
-
Discovery year2021-06-09
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameislet cell autoantigen 1
-
Synonyms gene name
- islet cell autoantigen 1 (69kD)
- islet cell autoantigen 1, 69kDa
-
Synonyms
-
Locus
-
Discovery year1992-08-24
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- AH domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data