Rabbit HSPE1 antibody
-
Catalog number70R-4219
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProtein Modification & Stress Response
-
ImmunogenHSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
-
SpecificityNA
-
Cross ReactivityHuman,Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPE1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHSPE1-MOB4, HSPE1
-
Short nameRabbit HSPE1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HSPE1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetheat shock 10kDa protein 1 (chaperonin 10), CPN10 and EPF and GROES and HSP10, HSPE1 and IDBG-78005 and ENSG00000115541 and 3336, chaperone binding, Plasma membranes, Hspe1 and IDBG-155256 and ENSMUSG00000073676 and 15528, HSPE1 and IDBG-642941 and ENSBTAG00000012589 and 281833
-
Gene info
-
Identity
-
Gene
-
Long gene nameHSPE1-MOB4 readthrough
-
Locus
-
Discovery year2013-09-25
-
Entrez gene record
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameheat shock protein family E (Hsp10) member 1
-
Synonyms gene name
- heat shock 10kD protein 1 (chaperonin 10)
- heat shock 10kDa protein 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1994-11-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Chaperonins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data