Rabbit HINT1 antibody
-
Catalog number70R-4222
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenHINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD
-
SpecificityHINT1 antibody was raised against the N terminal of HINT1
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HINT1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHINT1
-
Short nameRabbit HINT1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HINT1 antibody raised against the N terminal of HINT1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targethistidine triad nucleotide binding protein 1, HINT and NMAN and PKCI-1 and PRKCNH1, HINT1 and IDBG-40323 and ENSG00000169567 and 3094, hydrolase activity, nuclei, Hint1 and IDBG-174166 and ENSMUSG00000020267 and 15254, HINT1 and IDBG-644750 and ENSBTAG00000010959 and 327693
-
Gene info
-
Identity
-
Gene
-
Long gene namehistidine triad nucleotide binding protein 1
-
Synonyms gene
-
Synonyms gene name
- histidine triad nucleotide-binding protein
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1996-05-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Histidine triad superfamily
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data