Rabbit HEPACAM antibody

• Catalog number
  70R-6943
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT
• Specificity
  HEPACAM antibody was raised against the N terminal of HEPACAM
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HEPACAM antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  HEPACAM  
• Gene symbol
  HEPACAM
• Short name
  Rabbit HEPACAM antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal HEPACAM antibody raised against the N terminal of HEPACAM
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  hepatic and glial cell adhesion molecule, HEPACAM and IDBG-75353 and ENSG00000165478 and 220296,641654, protein binding, Cell surfaces, Hepacam and IDBG-150034 and ENSMUSG00000046240 and 72927, HEPACAM and IDBG-642655 and ENSBTAG00000018650 and 521015

Gene info

• Identity
  HGNC:26361
• Gene
  HEPACAM
• Long gene name
  hepatic and glial cell adhesion molecule
• Synonyms gene name
  • hepatocyte cell adhesion molecule
• Synonyms
  • FLJ25530
  • GLIALCAM
• Synonyms name
  • glial cell adhesion molecule
• GenBank acession
  • AK098396
• Locus
  11q24.2
• Discovery year
  2007-01-22
• Entrez gene record
  220296
• Pubmed identfication
  • 15885354
  • 15917256
• RefSeq identity
  • NM_152722
• Classification
  • Ig-like cell adhesion molecule family
  • V-set domain containing
• VEGA ID
  OTTHUMG00000165938

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products