Rabbit HELLS antibody
-
Catalog number70R-4647
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenHELLS antibody was raised using the middle region of HELLS corresponding to a region with amino acids QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD
-
SpecificityHELLS antibody was raised against the middle region of HELLS
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HELLS antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHELLS
-
Short nameRabbit HELLS antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HELLS antibody raised against the middle region of HELLS
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targethelicase, lymphoid-specific, LSH and PASG and SMARCA6, HELLS and IDBG-83141 and ENSG00000119969 and 3070, hydrolase activity, nuclei, Hells and IDBG-163438 and ENSMUSG00000025001 and 15201, HELLS and IDBG-637847 and ENSBTAG00000005979 and 540933
-
Gene info
-
Identity
-
Gene
-
Long gene namehelicase, lymphoid specific
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-07-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- DNA helicases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data