Rabbit HAX1 antibody
-
Catalog number70R-2545
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenHAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP
-
SpecificityHAX1 antibody was raised against the middle region of HAX1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HAX1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolHAX1
-
Short nameRabbit HAX1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal HAX1 antibody raised against the middle region of HAX1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetHCLS1 associated protein X-1, HCLSBP1 and HS1BP1 and SCN3, HAX1 and IDBG-102924 and ENSG00000143575 and 10456, protein N-terminus binding, nuclei, Hax1 and IDBG-165357 and ENSMUSG00000027944 and 23897, HAX1 and IDBG-632533 and ENSBTAG00000013025 and 506895
-
Gene info
-
Identity
-
Gene
-
Long gene nameHCLS1 associated protein X-1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2005-05-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data