Rabbit GRIN2A antibody
-
Catalog number70R-5207
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenGRIN2A antibody was raised using the middle region of GRIN2A corresponding to a region with amino acids DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
-
SpecificityGRIN2A antibody was raised against the middle region of GRIN2A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIN2A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGRIN2A
-
Short nameRabbit GRIN2A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GRIN2A antibody raised against the middle region of GRIN2A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetglutamate receptor, ionotropic, N-methyl D-aspartate 2A, EPND and FESD and GluN2A and LKS and NMDAR2A and NR2A, GRIN2A and IDBG-14127 and ENSG00000183454 and 2903, zinc ion binding, Cell surfaces, Grin2a and IDBG-131990 and ENSMUSG00000059003 and 14811, GRIN2A and IDBG-636790 and ENSBTAG00000007887 and
-
Gene info
-
Identity
-
Gene
-
Long gene nameglutamate ionotropic receptor NMDA type subunit 2A
-
Synonyms gene
-
Synonyms gene name
- glutamate receptor, ionotropic, N-methyl D-aspartate 2A
-
Synonyms
-
Locus
-
Discovery year1992-09-18
-
Pubmed identfication
-
Classification
- Glutamate ionotropic receptor NMDA type subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data