Rabbit GRIK2 antibody
-
Catalog number70R-5200
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenGRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST
-
SpecificityGRIK2 antibody was raised against the C terminal of GRIK2
-
Cross ReactivityHuman,Mouse,Rat,Dog,ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GRIK2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGRIK5, GRIK2
-
Short nameRabbit GRIK2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GRIK2 antibody raised against the C terminal of GRIK2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetglutamate receptor, ionotropic, kainate 2, EAA4 and GLR6 and GluK2 and GLUK6 and GLUR6 and MRT6, GRIK2 and IDBG-94705 and ENSG00000164418 and 2898, protein homodimerization activity, Cell surfaces, Grik2 and IDBG-149430 and ENSMUSG00000056073 and 14806, GRIK2 and IDBG-631973 and ENSBTAG00000033153 and 615226
-
Gene info
-
Identity
-
Gene
-
Long gene nameglutamate ionotropic receptor kainate type subunit 5
-
Synonyms gene
-
Synonyms gene name
- glutamate receptor, ionotropic, kainate 5
-
Synonyms
-
Locus
-
Discovery year1993-10-21
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Glutamate ionotropic receptor kainate type subunits
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameglutamate ionotropic receptor kainate type subunit 2
-
Synonyms gene
-
Synonyms gene name
- glutamate receptor, ionotropic, kainate 2
-
Synonyms
-
Locus
-
Discovery year1992-02-26
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Glutamate ionotropic receptor kainate type subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data