Rabbit GPC3 antibody
-
Catalog number70R-1567
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsIHC, WB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenGPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
-
SpecificityGPC3 antibody was raised against the middle region of GPC3
-
Cross ReactivityHuman, Mouse, Rat, Dog
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GPC3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGPC3-AS1, GPC3
-
Short nameRabbit GPC3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GPC3 antibody raised against the middle region of GPC3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetglypican 3, DGSX and GTR2-2 and MXR7 and OCI-5 and SDYS and SGB and SGBS and SGBS1, GPC3 and IDBG-86754 and ENSG00000147257 and 2719, peptidyl-dipeptidase inhibitor activity, Extracellular, Gpc3 and IDBG-145213 and ENSMUSG00000055653 and 14734, GPC3 and IDBG-630953 and ENSBTAG00000020406 and 615239
-
Gene info
-
Identity
-
Gene
-
Long gene nameGPC3 antisense RNA 1
-
GenBank acession
-
Locus
-
Discovery year2017-08-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameglypican 3
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-08-08
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Glypicans
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data