Rabbit GNAO1 antibody

  • Catalog number
    70R-5233
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    DNA & RNA
  • Immunogen
    GNAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPF
  • Specificity
    NA
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNAO1 antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    GNAO1  
  • Gene symbol
    GNAO1-DT, GNAO1-AS1, GNAO1
  • Short name
    Rabbit GNAO1 antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal GNAO1 antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O, EIEE17 and G-ALPHA-o and GNAO, GNAO1 and IDBG-31702 and ENSG00000087258 and 2775, corticotropin-releasing hormone receptor 1 binding, Plasma membranes, Gnao1 and IDBG-181138 and ENSMUSG00000031748 and 14681, GNAO1 and IDBG-632074 and ENSBTAG00000003794 and 281792
Gene info
  • Identity
  • Gene
  • Long gene name
    GNAO1 divergent transcript
  • Locus
  • Discovery year
    2021-04-29
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Divergent transcripts
Gene info
  • Identity
  • Gene
  • Long gene name
    GNAO1 antisense RNA 1
  • Locus
  • Discovery year
    2020-11-11
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Antisense RNAs
Gene info
  • Identity
  • Gene
  • Long gene name
    G protein subunit alpha o1
  • Synonyms gene name
    • guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
  • Synonyms
  • Locus
  • Discovery year
    1988-04-24
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • G protein subunits alpha, group i
    • MicroRNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee