Rabbit GNA12 antibody
-
Catalog number70R-3131
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenGNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GNA12 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGNA12
-
Short nameRabbit GNA12 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GNA12 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetguanine nucleotide binding protein (G protein) alpha 12, gep and NNX3 and RMP, GNA12 and IDBG-7130 and ENSG00000146535 and 2768, metal ion binding, Plasma membranes, Gna12 and IDBG-207106 and ENSMUSG00000000149 and 14673, GNA12 and IDBG-641207 and ENSBTAG00000017871 and 515159
-
Gene info
-
Identity
-
Gene
-
Long gene nameG protein subunit alpha 12
-
Synonyms gene name
- guanine nucleotide binding protein (G protein) alpha 12
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1993-07-26
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data