Rabbit GLMN antibody
-
Catalog number70R-5818
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDifferentiation & Development
-
ImmunogenGLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL
-
SpecificityGLMN antibody was raised against the middle region of GLMN
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLMN antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGLMN
-
Short nameRabbit GLMN antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GLMN antibody raised against the middle region of GLMN
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetglomulin, FKBP associated protein, FAP and FAP48 and FAP68 and FKBPAP and GLML and GVM and VMGLOM, GLMN and IDBG-100272 and ENSG00000174842 and 11146, ubiquitin-protein transferase inhibitor activity, multiple, Glmn and IDBG-187045 and ENSMUSG00000029276 and 170823, GLMN and IDBG-636586 and ENSBTAG00000018737 and 504211
-
Gene info
-
Identity
-
Gene
-
Long gene nameglomulin, FKBP associated protein
-
Synonyms gene
-
Synonyms gene name
- venous malformation with glomus cells
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2003-07-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data