Rabbit GLMN antibody

  • Catalog number
    70R-5818
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Differentiation & Development
  • Immunogen
    GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYL
  • Specificity
    GLMN antibody was raised against the middle region of GLMN
  • Cross Reactivity
    Human,Mouse,Rat
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLMN antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    GLMN  
  • Gene symbol
    GLMN
  • Short name
    Rabbit GLMN antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal GLMN antibody raised against the middle region of GLMN
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    glomulin, FKBP associated protein, FAP and FAP48 and FAP68 and FKBPAP and GLML and GVM and VMGLOM, GLMN and IDBG-100272 and ENSG00000174842 and 11146, ubiquitin-protein transferase inhibitor activity, multiple, Glmn and IDBG-187045 and ENSMUSG00000029276 and 170823, GLMN and IDBG-636586 and ENSBTAG00000018737 and 504211
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee