Rabbit GDF15 antibody
-
Catalog number70R-6225
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenGDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP
-
SpecificityGDF15 antibody was raised against the N terminal of GDF15
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDF15 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolGDF15
-
Short nameRabbit GDF15 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal GDF15 antibody raised against the N terminal of GDF15
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetgrowth differentiation factor 15, GDF-15 and MIC-1 and MIC1 and NAG-1 and PDF and PLAB and PTGFB, GDF15 and IDBG-38078 and ENSG00000130513 and 9518, growth factor activity, Extracellular, Gdf15 and IDBG-163724 and ENSMUSG00000038508 and 23886, GDF15 and IDBG-641726 and ENSBTAG00000015618 and 618677
-
Gene info
-
Identity
-
Gene
-
Long gene namegrowth differentiation factor 15
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-02-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Transforming growth factor beta superfamily
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data