Rabbit GAPVD1 antibody

• Catalog number
  70R-2122
• Price
  Please ask
• Size
  50 ug

• Applications
  WB, IHC
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  GAPVD1 antibody was raised using the N terminal of GAPVD1 corresponding to a region with amino acids FKLFSEGLFSAKLFLTATLHEPIMQLLVEDEDHLETDPNKLIERFSPSQQ
• Specificity
  GAPVD1 antibody was raised against the N terminal of GAPVD1
• Cross Reactivity
  Human, Mouse, Rat, Dog
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAPVD1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  GAPVD1  
• Gene symbol
  GAPVD1
• Short name
  Rabbit GAPVD1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal GAPVD1 antibody raised against the N terminal of GAPVD1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  GTPase activating protein and VPS9 domains 1, GAPVD1 and IDBG-85167 and ENSG00000165219 and 26130, GTPase activating protein binding, Plasma membranes, Gapvd1 and IDBG-163056 and ENSMUSG00000026867 and 66691, GAPVD1 and IDBG-638740 and ENSBTAG00000011544 and 539646

Gene info

• Identity
  HGNC:23375
• Gene
  GAPVD1
• Long gene name
  GTPase activating protein and VPS9 domains 1
• Synonyms
  • DKFZP434C212
  • KIAA1521
• Locus
  9q33.3
• Discovery year
  2005-03-22
• Entrez gene record
  26130
• Classification
  • VPS9 domain containing
• VEGA ID
  OTTHUMG00000020678

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products