Rabbit FZD4 antibody
-
Catalog number70R-7474
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB, IHC
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFZD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FZD4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFZD4-DT, FZD4
-
Short nameRabbit FZD4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FZD4 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetfrizzled family receptor 4, CD344 and EVR1 and FEVR and Fz-4 and Fz4 and FZD4S and FzE4 and GPCR and hFz4, FZD4 and IDBG-67034 and ENSG00000174804 and 8322, protein heterodimerization activity, Cell surfaces, Fzd4 and IDBG-198316 and ENSMUSG00000049791 and 14366, FZD4 and IDBG-641882 and ENSBTAG00000040128 and 445416
-
Gene info
-
Identity
-
Gene
-
Long gene nameFZD4 divergent transcript
-
Locus
-
Discovery year2019-04-09
-
Entrez gene record
-
RefSeq identity
-
Classification
- Divergent transcripts
Gene info
-
Identity
-
Gene
-
Long gene namefrizzled class receptor 4
-
Synonyms gene
-
Synonyms gene name
- frizzled (Drosophila) homolog 4
- exudative vitreoretinopathy 1
- frizzled homolog 4 (Drosophila)
- frizzled 4, seven transmembrane spanning receptor
- frizzled family receptor 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-09-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- G protein-coupled receptors, Class F frizzled
- CD molecules
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data