Rabbit FYN antibody
-
Catalog number70R-5772
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenFYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
-
SpecificityFYN antibody was raised against the N terminal of FYN
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FYN antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFYN
-
Short nameRabbit FYN antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FYN antibody raised against the N terminal of FYN
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFYN oncogene related to SRC, FGR, YES, p59-FYN and SLK and SYN, FYN and IDBG-95463 and ENSG00000010810 and 102724705,2534, transferase activity, nuclei, Fyn and IDBG-144629 and ENSMUSG00000019843 and 14360, FYN and IDBG-631420 and ENSBTAG00000011851 and 527263
-
Gene info
-
Identity
-
Gene
-
Long gene nameFYN proto-oncogene, Src family tyrosine kinase
-
Synonyms gene name
- FYN oncogene related to SRC, FGR, YES
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1988-08-19
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Src family tyrosine kinases
- SH2 domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data