Rabbit FKBPL antibody

• Catalog number
  70R-3368
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Signal Transduction
• Immunogen
  FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE
• Specificity
  FKBPL antibody was raised against the N terminal of FKBPL
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBPL antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  FKBPL  
• Gene symbol
  FKBPL
• Short name
  Rabbit FKBPL antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal FKBPL antibody raised against the N terminal of FKBPL
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  FK506 binding protein like, FKBPL and IDBG-80270 and ENSG00000204315 and 63943, FK506 binding, Cytoplasm, Fkbpl and IDBG-172572 and ENSMUSG00000033739 and 56299, BT.24583 and IDBG-633141 and ENSBTAG00000037781 and 513929

Gene info

• Identity
  HGNC:13949
• Gene
  FKBPL
• Long gene name
  FKBP prolyl isomerase like
• Synonyms gene name
  • FK506-binding protein like
  • FK506 binding protein like
• Synonyms
  • DIR1
  • NG7
  • WISp39
• Synonyms name
  • WAF-1/CIP1 stabilizing protein 39
• GenBank acession
  • AF139374
• Locus
  6p21.32
• Discovery year
  2001-04-06
• Entrez gene record
  63943
• Pubmed identfication
  • 9056895
• Classification
  • Tetratricopeptide repeat domain containing
  • FKBP prolyl isomerases
• VEGA ID
  OTTHUMG00000031129

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products