Rabbit FKBPL antibody
-
Catalog number70R-3368
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELE
-
SpecificityFKBPL antibody was raised against the N terminal of FKBPL
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBPL antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFKBPL
-
Short nameRabbit FKBPL antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FKBPL antibody raised against the N terminal of FKBPL
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFK506 binding protein like, FKBPL and IDBG-80270 and ENSG00000204315 and 63943, FK506 binding, Cytoplasm, Fkbpl and IDBG-172572 and ENSMUSG00000033739 and 56299, BT.24583 and IDBG-633141 and ENSBTAG00000037781 and 513929
-
Gene info
-
Identity
-
Gene
-
Long gene nameFKBP prolyl isomerase like
-
Synonyms gene name
- FK506-binding protein like
- FK506 binding protein like
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-04-06
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Tetratricopeptide repeat domain containing
- FKBP prolyl isomerases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data