Rabbit FKBP3 antibody
-
Catalog number70R-2287
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
-
SpecificityFKBP3 antibody was raised against the C terminal of FKBP3
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFKBP3
-
Short nameRabbit FKBP3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FKBP3 antibody raised against the C terminal of FKBP3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFK506 binding protein 3, 25kDa, FKBP-25 and FKBP-3 and FKBP25 and PPIase, FKBP3 and IDBG-5577 and ENSG00000100442 and 2287, poly(A) RNA binding, nuclei, Fkbp3 and IDBG-143170 and ENSMUSG00000020949 and 30795, FKBP3 and IDBG-633002 and ENSBTAG00000002610 and 515069
-
Gene info
-
Identity
-
Gene
-
Long gene nameFKBP prolyl isomerase 3
-
Synonyms gene name
- FK506-binding protein 3 (25kD)
- FK506 binding protein 3, 25kDa
- FK506 binding protein 3
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1992-09-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- FKBP prolyl isomerases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data