Rabbit FKBP2 antibody
-
Catalog number70R-5298
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV
-
SpecificityFKBP2 antibody was raised against the N terminal of FKBP2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFKBP2
-
Short nameRabbit FKBP2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FKBP2 antibody raised against the N terminal of FKBP2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFK506 binding protein 2, 13kDa, FKBP-13 and PPIase, FKBP2 and IDBG-53311 and ENSG00000173486 and 2286, FK506 binding, Cytoplasm, Fkbp2 and IDBG-137677 and ENSMUSG00000056629 and 14227
-
Gene info
-
Identity
-
Gene
-
Long gene nameFKBP prolyl isomerase 2
-
Synonyms gene name
- FK506-binding protein 2 (13kD)
- FK506 binding protein 2, 13kDa
- FK506 binding protein 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1992-09-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- FKBP prolyl isomerases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data