Rabbit FGF2 antibody
-
Catalog number70R-4603
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenFGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGF2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFGF2, FGF13
-
Short nameRabbit FGF2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FGF2 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetfibroblast growth factor 2 (basic), BFGF and FGF-2 and FGFB and HBGF-2, FGF2 and IDBG-37039 and ENSG00000138685 and 2247, chemoattractant activity, nuclei, Fgf2 and IDBG-140464 and ENSMUSG00000037225 and 14173, BT.66957 and IDBG-630303 and ENSBTAG00000005691 and 281161
-
Gene info
-
Identity
-
Gene
-
Long gene namefibroblast growth factor 2
-
Synonyms gene
-
Synonyms gene name
- fibroblast growth factor 2 (basic)
-
GenBank acession
-
Locus
-
Discovery year1986-01-01
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibroblast growth factor family
- Receptor ligands
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namefibroblast growth factor 13
-
Synonyms gene
-
Synonyms gene name
- long intergenic non-protein coding RNA 889
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-12-16
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibroblast growth factor family
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data