Rabbit FERMT1 antibody
-
Catalog number70R-2667
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
-
SpecificityNA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FERMT1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFERMT1
-
Short nameRabbit FERMT1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FERMT1 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetfermitin family member 1, FERMT1 and IDBG-52257 and ENSG00000101311 and 55612, Cell surfaces, Fermt1 and IDBG-207575 and ENSMUSG00000027356 and 241639, FERMT1 and IDBG-639910 and ENSBTAG00000020465 and 524427
-
Gene info
-
Identity
-
Gene
-
Long gene nameFERM domain containing kindlin 1
-
Synonyms gene
-
Synonyms gene name
- chromosome 20 open reading frame 42
- fermitin family homolog 1 (Drosophila)
- fermitin family member 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-06-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- FERM domain containing
- Fermitins
- Pleckstrin homology domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data