Rabbit FCGRT antibody
-
Catalog number70R-5991
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenFCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
-
SpecificityFCGRT antibody was raised against the N terminal of FCGRT
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FCGRT antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFCGRT
-
Short nameRabbit FCGRT antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FCGRT antibody raised against the N terminal of FCGRT
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFc fragment of IgG, receptor, transporter, alpha, alpha-chain and FCRN, FCGRT and IDBG-63001 and ENSG00000104870 and 2217, beta-2-microglobulin binding, Plasma membranes, Fcgrt and IDBG-181534 and ENSMUSG00000003420 and 14132, FCGRT and IDBG-640575 and ENSBTAG00000013926 and 338062
-
Gene info
-
Identity
-
Gene
-
Long gene nameFc fragment of IgG receptor and transporter
-
Synonyms gene name
- Fc fragment of IgG, receptor, transporter, alpha
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1995-08-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- C1-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data