Rabbit FASTKD2 antibody
-
Catalog number70R-3176
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenFASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
-
SpecificityFASTKD2 antibody was raised against the middle region of FASTKD2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FASTKD2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFASTKD2
-
Short nameRabbit FASTKD2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FASTKD2 antibody raised against the middle region of FASTKD2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFAST kinase domains 2, KIAA0971, FASTKD2 and IDBG-79511 and ENSG00000118246 and 22868, poly(A) RNA binding, multiple, Fastkd2 and IDBG-161080 and ENSMUSG00000025962 and 75619, BT.28280 and IDBG-643449 and ENSBTAG00000016193 and 528207
-
Gene info
-
Identity
-
Gene
-
Long gene nameFAST kinase domains 2
-
Synonyms gene
-
Synonyms gene name
- KIAA0971
-
GenBank acession
-
Locus
-
Discovery year2004-06-28
-
Entrez gene record
-
RefSeq identity
-
Classification
- FASTK mitochondrial RNA binding family
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data