Rabbit FADD antibody
-
Catalog number70R-3423
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaImmunology
-
ImmunogenFADD antibody was raised using a synthetic peptide corresponding to a region with amino acids ASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP
-
SpecificityNA
-
Cross Reactivitymouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FADD antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolFADD
-
Short nameRabbit FADD antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal FADD antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetFas (TNFRSF6)-associated via death domain, MORT1, FADD and IDBG-62144 and ENSG00000168040 and 8772, identical protein binding, Plasma membranes, Fadd and IDBG-212910 and ENSMUSG00000031077 and 14082, FADD and IDBG-645056 and ENSBTAG00000018274 and 493720
-
Gene info
-
Identity
-
Gene
-
Long gene nameFas associated via death domain
-
Synonyms gene name
- Fas (TNFRSF6)-associated via death domain
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-05-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Death effector domain containing
- Death inducing signaling complex
- Ripoptosome
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data