Rabbit EXOC8 antibody
-
Catalog number70R-4492
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenEXOC8 antibody was raised using the N terminal of EXOC8 corresponding to a region with amino acids MAMAMSDSGASRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQA
-
SpecificityEXOC8 antibody was raised against the N terminal of EXOC8
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EXOC8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolEXOC8
-
Short nameRabbit EXOC8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal EXOC8 antibody raised against the N terminal of EXOC8
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetexocyst complex component 8, EXOC8 and IDBG-107417 and ENSG00000116903 and 149371, protein binding, Plasma membranes, Exoc8 and IDBG-200529 and ENSMUSG00000074030 and 102058, EXOC8 and IDBG-648959 and ENSBTAG00000006111 and 540237
-
Gene info
-
Identity
-
Gene
-
Long gene nameexocyst complex component 8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-01-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Exocyst complex
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data