Rabbit ERCC8 antibody
-
Catalog number70R-2728
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenERCC8 antibody was raised using the middle region of ERCC8 corresponding to a region with amino acids FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE
-
SpecificityERCC8 antibody was raised against the middle region of ERCC8
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolERCC8-AS1, ERCC8
-
Short nameRabbit ERCC8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ERCC8 antibody raised against the middle region of ERCC8
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetexcision repair cross-complementing rodent repair deficiency, complementation group 8, CKN1 and CSA and UVSS2, ERCC8 and IDBG-22959 and ENSG00000049167 and 1161, protein complex binding, nuclei, Ercc8 and IDBG-181454 and ENSMUSG00000021694 and 71991, ERCC8 and IDBG-628902 and ENSBTAG00000021606 and 518857
-
Gene info
-
Identity
-
Gene
-
Long gene nameERCC8 antisense RNA 1
-
Locus
-
Discovery year2019-07-25
-
Entrez gene record
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene nameERCC excision repair 8, CSA ubiquitin ligase complex subunit
-
Synonyms gene
-
Synonyms gene name
- Cockayne syndrome 1 (classical)
- excision repair cross-complementing rodent repair deficiency, complementation group 8
- excision repair cross-complementation group 8
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1995-02-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- WD repeat domain containing
- ERCC excision repair associated
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data