Rabbit ERCC6L antibody

• Catalog number
  70R-3241
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  ERCC6L antibody was raised using the N terminal Of Ercc6L corresponding to a region with amino acids GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS
• Specificity
  ERCC6L antibody was raised against the N terminal Of Ercc6L
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC6L antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ERCC6L  
• Gene symbol
  ERCC6L
• Short name
  Rabbit ERCC6L antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ERCC6L antibody raised against the N terminal Of Ercc6L
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  excision repair cross-complementing rodent repair deficiency, complementation group 6-like, ERCC6L and IDBG-76512 and ENSG00000186871 and 54821, hydrolase activity, Plasma membranes, Ercc6l and IDBG-164906 and ENSMUSG00000051220 and 236930, ERCC6L and IDBG-635704 and ENSBTAG00000005607 and 782916

Gene info

• Identity
  HGNC:20794
• Gene
  ERCC6L
• Long gene name
  ERCC excision repair 6 like, spindle assembly checkpoint helicase
• Synonyms gene name
  • excision repair cross-complementing rodent repair deficiency, complementation group 6-like
  • excision repair cross-complementation group 6 like
• Synonyms
  • FLJ20105
  • PICH
  • RAD26L
• Synonyms name
  • PLK1-interacting checkpoint helicase
• GenBank acession
  • AK000112
• Locus
  Xq13.1
• Discovery year
  2007-08-02
• Entrez gene record
  54821
• Pubmed identfication
  • 17218258
  • 26643143
• RefSeq identity
  • NM_017669
• VEGA ID
  OTTHUMG00000021810

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products