Rabbit ERCC5 antibody
-
Catalog number70R-3326
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenERCC5 antibody was raised using the N terminal of ERCC5 corresponding to a region with amino acids NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ
-
SpecificityERCC5 antibody was raised against the N terminal of ERCC5
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERCC5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBIVM-ERCC5, ERCC5
-
Short nameRabbit ERCC5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ERCC5 antibody raised against the N terminal of ERCC5
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetexcision repair cross-complementing rodent repair deficiency, complementation group 5, COFS3 and ERCC5-201 and ERCM2 and UVDR and XPG and XPGC, ERCC5 and IDBG-49163 and ENSG00000134899 and 2073, protein N-terminus binding, nuclei
-
Gene info
-
Identity
-
Gene
-
Long gene nameBIVM-ERCC5 readthrough
-
GenBank acession
-
Locus
-
Discovery year2013-05-10
-
Entrez gene record
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameERCC excision repair 5, endonuclease
-
Synonyms gene
-
Synonyms gene name
- xeroderma pigmentosum, complementation group G
- excision repair cross-complementing rodent repair deficiency, complementation group 5
- excision repair cross-complementation group 5
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Xeroderma pigmentosum complementation groups
- ERCC excision repair associated
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data