Rabbit ELMOD2 antibody
-
Catalog number70R-6024
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenELMOD2 antibody was raised using the N terminal of ELMOD2 corresponding to a region with amino acids FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN
-
SpecificityELMOD2 antibody was raised against the N terminal of ELMOD2
-
Cross ReactivityHuman, Mouse
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ELMOD2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolELMOD2
-
Short nameRabbit ELMOD2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal ELMOD2 antibody raised against the N terminal of ELMOD2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetELMO/CED-12 domain containing 2, ELMOD2 and IDBG-38838 and ENSG00000179387 and 255520, GTPase activator activity, Plasma membranes, Elmod2 and IDBG-171885 and ENSMUSG00000035151 and 244548, ELMOD2 and IDBG-629686 and ENSBTAG00000014007 and 515278
-
Gene info
-
Identity
-
Gene
-
Long gene nameELMO domain containing 2
-
Synonyms gene name
- ELMO/CED-12 domain containing 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-08-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- ELMO domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data