Rabbit EHD4 antibody
-
Catalog number70R-2680
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenEHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT
-
SpecificityEHD4 antibody was raised against the middle region of EHD4
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EHD4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolEHD4-AS1, EHD4
-
Short nameRabbit EHD4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal EHD4 antibody raised against the middle region of EHD4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetEH-domain containing 4, EHD4 and IDBG-7456 and ENSG00000103966 and 30844, GTP binding, nuclei, Ehd4 and IDBG-200475 and ENSMUSG00000027293 and 98878, EHD4 and IDBG-646322 and ENSBTAG00000006792 and 505206
-
Gene info
-
Identity
-
Gene
-
Long gene nameEHD4 antisense RNA 1
-
GenBank acession
-
Locus
-
Discovery year2014-11-21
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameEH domain containing 4
-
Synonyms gene
-
GenBank acession
-
Locus
-
Discovery year2000-03-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- EF-hand domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data