Rabbit EGLN3 antibody
-
Catalog number70R-2564
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenEGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EGLN3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolEGLN3-AS1, EGLN3
-
Short nameRabbit EGLN3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal EGLN3 antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetegl nine homolog 3 (C. elegans), EGLN3 and IDBG-4515 and ENSG00000129521 and 102724945,112399, oxidoreductase activity, nuclei, Egln3 and IDBG-139438 and ENSMUSG00000035105 and 112407, EGLN3 and IDBG-632414 and ENSBTAG00000008172 and 535578
-
Gene info
-
Identity
-
Gene
-
Long gene nameEGLN3 antisense RNA 1
-
GenBank acession
-
Locus
-
Discovery year2013-08-23
-
Classification
- Antisense RNAs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameegl-9 family hypoxia inducible factor 3
-
Synonyms gene name
- egl nine homolog 3 (C. elegans)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-08-21
-
Entrez gene record
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data