Rabbit EBI3 antibody
-
Catalog number70R-3648
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaInfectious Disease
-
ImmunogenEBI3 antibody was raised using the middle region of EBI3 corresponding to a region with amino acids TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP
-
SpecificityEBI3 antibody was raised against the middle region of EBI3
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EBI3 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolEBI3
-
Short nameRabbit EBI3 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal EBI3 antibody raised against the middle region of EBI3
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetEpstein-Barr virus induced 3, IL-27B and IL27B, EBI3 and IDBG-18580 and ENSG00000105246 and 10148, interleukin-27 receptor binding, Extracellular, Ebi3 and IDBG-191286 and ENSMUSG00000003206 and 50498, EBI3 and IDBG-644295 and ENSBTAG00000012829 and 514933
-
Gene info
-
Identity
-
Gene
-
Long gene nameEpstein-Barr virus induced 3
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-05-02
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Fibronectin type III domain containing
- Minor histocompatibility antigens
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data