Rabbit DNASE1 antibody

• Catalog number
  70R-6299
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  DNA & RNA
• Immunogen
  DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
• Specificity
  DNASE1 antibody was raised against the N terminal of DNASE1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DNASE1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  DNASE1  
• Gene symbol
  DNASE1
• Short name
  Rabbit DNASE1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal DNASE1 antibody raised against the N terminal of DNASE1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  deoxyribonuclease I, DNL1 and DRNI, DNASE1 and IDBG-236686 and ENSG00000213918 and 1773, endodeoxyribonuclease activity, nuclei, Dnase1 and IDBG-129416 and ENSMUSG00000005980 and 13419, DNASE1 and IDBG-636027 and ENSBTAG00000020107 and 282217

Gene info

• Identity
  HGNC:2956
• Gene
  DNASE1
• Long gene name
  deoxyribonuclease 1
• Synonyms gene
  • DNL1
• Synonyms gene name
  • deoxyribonuclease I
• Locus
  16p13.3
• Discovery year
  1992-07-08
• Entrez gene record
  1773
• Pubmed identfication
  • 2349940
• VEGA ID
  OTTHUMG00000129426

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products