Rabbit DMBT1 antibody

• Catalog number
  70R-3916
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cancer
• Immunogen
  DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
• Specificity
  DMBT1 antibody was raised against the N terminal of DMBT1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DMBT1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  DMBT1  
• Gene symbol
  DMBT1
• Short name
  Rabbit DMBT1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal DMBT1 antibody raised against the N terminal of DMBT1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  deleted in malignant brain tumors 1, GP340 and muclin, DMBT1 and IDBG-91946 and ENSG00000187908 and 1755, calcium-dependent protein binding, Extracellular, Dmbt1 and IDBG-210881 and ENSMUSG00000047517 and 12945, DMBT1 and IDBG-640676 and ENSBTAG00000022715 and

Gene info

• Identity
  HGNC:2926
• Gene
  DMBT1
• Long gene name
  deleted in malignant brain tumors 1
• Synonyms
  • GP340
  • muclin
  • SALSA
  • Gp-340
  • hensin
  • vomeroglandin
• Synonyms name
  • salivary agglutinin
  • salivary scavenger and agglutinin
• Locus
  10q26.13
• Discovery year
  1997-09-05
• Entrez gene record
  1755
• Pubmed identfication
  • 9288095
  • 17548659
• RefSeq identity
  • NM_004406
• Classification
  • Scavenger receptor cysteine rich domain containing
• VEGA ID
  OTTHUMG00000019185

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products