Rabbit DGKA antibody

  • Catalog number
    70R-5806
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Signal Transduction
  • Immunogen
    DGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
  • Specificity
    DGKA antibody was raised against the N terminal of DGKA
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKA antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    DGKA  
  • Gene symbol
    DGKA
  • Short name
    Rabbit DGKA antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal DGKA antibody raised against the N terminal of DGKA
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    diacylglycerol kinase, alpha 80kDa, DAGK and DAGK1 and DGK-alpha, DGKA and IDBG-39397 and ENSG00000065357 and 1606, phospholipid binding, Plasma membranes, Dgka and IDBG-198283 and ENSMUSG00000025357 and 13139, DGKA and IDBG-636422 and ENSBTAG00000004018 and 506348
Gene info
  • Identity
  • Gene
  • Long gene name
    diacylglycerol kinase alpha
  • Synonyms gene
  • Synonyms gene name
    • diacylglycerol kinase, alpha (80kD)
    • diacylglycerol kinase, alpha 80kDa
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1991-08-21
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Diacylglycerol kinases
    • EF-hand domain containing
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee