Rabbit DGKA antibody
-
Catalog number70R-5806
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenDGKA antibody was raised using the N terminal of DGKA corresponding to a region with amino acids EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
-
SpecificityDGKA antibody was raised against the N terminal of DGKA
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGKA antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDGKA
-
Short nameRabbit DGKA antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DGKA antibody raised against the N terminal of DGKA
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetdiacylglycerol kinase, alpha 80kDa, DAGK and DAGK1 and DGK-alpha, DGKA and IDBG-39397 and ENSG00000065357 and 1606, phospholipid binding, Plasma membranes, Dgka and IDBG-198283 and ENSMUSG00000025357 and 13139, DGKA and IDBG-636422 and ENSBTAG00000004018 and 506348
-
Gene info
-
Identity
-
Gene
-
Long gene namediacylglycerol kinase alpha
-
Synonyms gene
-
Synonyms gene name
- diacylglycerol kinase, alpha (80kD)
- diacylglycerol kinase, alpha 80kDa
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1991-08-21
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Diacylglycerol kinases
- EF-hand domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data