Rabbit DGCR8 antibody
-
Catalog number70R-4730
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaDNA & RNA
-
ImmunogenDGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
-
SpecificityDGCR8 antibody was raised against the N terminal of DGCR8
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DGCR8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDGCR8
-
Short nameRabbit DGCR8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DGCR8 antibody raised against the N terminal of DGCR8
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetDiGeorge syndrome critical region gene 8, DGCR8 and IDBG-1583 and ENSG00000128191 and 100302197,54487, metal ion binding, nuclei, Dgcr8 and IDBG-141484 and ENSMUSG00000022718 and 94223, DGCR8 and IDBG-638235 and ENSBTAG00000019869 and 540254
-
Gene info
-
Identity
-
Gene
-
Long gene nameDGCR8 microprocessor complex subunit
-
Synonyms gene
-
Synonyms gene name
- chromosome 22 open reading frame 12
- DiGeorge syndrome critical region gene 8
- DGCR8, microprocessor complex subunit
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-06-29
-
Entrez gene record
-
Pubmed identfication
-
Classification
- MicroRNA protein coding host genes
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data