Rabbit DFFB antibody

• Catalog number
  70R-5928
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Cycle & Cell Death
• Immunogen
  DFFB antibody was raised using a synthetic peptide corresponding to a region with amino acids EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DFFB antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  DFFB  
• Gene symbol
  DFFB
• Short name
  Rabbit DFFB antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal DFFB antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), CAD and CPAN and DFF-40 and DFF2 and DFF40, DFFB and IDBG-86952 and ENSG00000169598 and 1677, enzyme binding, nuclei, Dffb and IDBG-206807 and ENSMUSG00000029027 and 13368, BT.22809 and IDBG-634397 and ENSBTAG00000020015 and 512730

Gene info

• Identity
  HGNC:2773
• Gene
  DFFB
• Long gene name
  DNA fragmentation factor subunit beta
• Synonyms gene name
  • DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
• Synonyms
  • CAD
  • CPAN
  • DFF-40
  • DFF40
• Synonyms name
  • caspase-activated DNase
• Locus
  1p36.32
• Discovery year
  1997-10-27
• Entrez gene record
  1677
• Pubmed identfication
  • 9108473
  • 9560346
• RefSeq identity
  • NM_001282669
• VEGA ID
  OTTHUMG00000003525

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products