Rabbit DENND1A antibody
-
Catalog number70R-3137
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenDENND1A antibody was raised using the N terminal of DENND1A corresponding to a region with amino acids PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML
-
SpecificityDENND1A antibody was raised against the N terminal of DENND1A
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DENND1A antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDENND1A
-
Short nameRabbit DENND1A antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DENND1A antibody raised against the N terminal of DENND1A
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetDENN/MADD domain containing 1A, DENND1A and IDBG-84620 and ENSG00000119522 and 57706, SH3 domain binding, Cell surfaces, Dennd1a and IDBG-166357 and ENSMUSG00000035392 and 227801, DENND1A and IDBG-638649 and ENSBTAG00000003610 and 514134
-
Gene info
-
Identity
-
Gene
-
Long gene nameDENN domain containing 1A
-
Synonyms gene
-
Synonyms gene name
- KIAA1608
- DENN/MADD domain containing 1A
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2004-01-29
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- MicroRNA protein coding host genes
- DENN domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data