Rabbit DCC antibody
-
Catalog number70R-4484
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCancer
-
ImmunogenDCC antibody was raised using the middle region of DCC corresponding to a region with amino acids PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ
-
SpecificityDCC antibody was raised against the middle region of DCC
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DCC antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolDCC
-
Short nameRabbit DCC antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal DCC antibody raised against the middle region of DCC
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetdeleted in colorectal carcinoma, CRC18 and CRCR1 and IGDCC1 and MRMV1 and NTN1R1, DCC and IDBG-3511 and ENSG00000187323 and 1630, identical protein binding, Plasma membranes, Dcc and IDBG-157336 and ENSMUSG00000060534 and 13176
-
Gene info
-
Identity
-
Gene
-
Long gene nameDCC netrin 1 receptor
-
Synonyms gene name
- deleted in colorectal carcinoma
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1990-05-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibronectin type III domain containing
- MicroRNA protein coding host genes
- I-set domain containing
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data