Rabbit CXCL16 antibody

• Catalog number
  70R-6007
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cytokines & Growth Factors
• Immunogen
  CXCL16 antibody was raised using a synthetic peptide corresponding to a region with amino acids TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXCL16 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  CXCL16  
• Gene symbol
  CXCL16
• Short name
  Rabbit CXCL16 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal CXCL16 antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  chemokine (C-X-C motif) ligand 16, CXCL16 and IDBG-19403 and ENSG00000161921 and 58191, chemokine activity, Extracellular, Cxcl16 and IDBG-194380 and ENSMUSG00000018920 and 66102, CXCL16 and IDBG-634352 and ENSBTAG00000031998 and 511671

Gene info

• Identity
  HGNC:16642
• Gene
  CXCL16
• Long gene name
  C-X-C motif chemokine ligand 16
• Synonyms gene name
  • chemokine (C-X-C motif) ligand 16
• Synonyms
  • SR-PSOX
  • CXCLG16
  • SRPSOX
• Synonyms name
  • CXC chemokine ligand 16
• GenBank acession
  • AF275260
• Locus
  17p13.2
• Discovery year
  2001-09-21
• Entrez gene record
  58191
• Pubmed identfication
  • 11017100
  • 11060282
• RefSeq identity
  • NM_022059
• Classification
  • Chemokine ligands
  • Scavenger receptors
• VEGA ID
  OTTHUMG00000090761

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products