Rabbit Cullin 5 antibody
-
Catalog number70R-1629
-
PricePlease ask
-
Size100 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCullin 5 antibody was raised using the C terminal of CUL5 corresponding to a region with amino acids VNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHH
-
SpecificityCullin 5 antibody was raised against the C terminal of CUL5
-
Cross ReactivityHuman, Mouse, Rat, Dog, ZebraFish
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CUL5 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCUL5, DCUN1D5
-
Short nameRabbit Cullin 5 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal Cullin 5 antibody raised against the C terminal of CUL5
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene namecullin 5
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1998-12-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Cullins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namedefective in cullin neddylation 1 domain containing 5
-
Synonyms gene name
- DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae)
-
Synonyms
-
Locus
-
Discovery year2005-10-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data