Rabbit CRP antibody
-
Catalog number70R-4527
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCardiac Markers
-
ImmunogenCRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA
-
SpecificityCRP antibody was raised against the N terminal of CRP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
GeneC reactive proteins are detected by anti-CRP antibodies supplied by GENTAUR.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCRP, PPIAP10
-
Short nameRabbit CRP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CRP antibody raised against the N terminal of CRP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetC-reactive protein, pentraxin-related, PTX1, CRP and IDBG-103911 and ENSG00000132693 and 1401, protein homodimerization activity, Extracellular, Crp and IDBG-205690 and ENSMUSG00000037942 and 12944, CRP and IDBG-630749 and ENSBTAG00000013907 and 527553
-
Gene info
-
Identity
-
Gene
-
Long gene nameC-reactive protein
-
Synonyms gene name
- C-reactive protein, pentraxin-related
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-06-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Short pentraxins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namepeptidylprolyl isomerase A pseudogene 10
-
Synonyms gene
-
Synonyms gene name
- peptidylprolyl isomerase A (cyclophilin A)-like 2
- peptidylprolyl isomerase (cyclophilin) pseudogene 10
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-10-12
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data