Rabbit CRLF2 antibody
-
Catalog number70R-4480
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenCRLF2 antibody was raised using the middle region of CRLF2 corresponding to a region with amino acids FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
-
SpecificityCRLF2 antibody was raised against the middle region of CRLF2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRLF2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCRLF2
-
Short nameRabbit CRLF2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CRLF2 antibody raised against the middle region of CRLF2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcytokine receptor-like factor 2, CRLF2 and IDBG-39359 and ENSG00000205755 and 64109, protein binding, Extracellular, Crlf2 and IDBG-188983 and ENSMUSG00000033467 and 57914, CRLF2 and IDBG-645338 and ENSBTAG00000020242 and 529792
-
Gene info
-
Identity
-
Gene
-
Long gene namecytokine receptor like factor 2
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2001-02-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Fibronectin type III domain containing
- Pseudoautosomal region 1
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data