Rabbit COX10 antibody
#
-
Catalog number70R-6479
-
Price:
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaProteases, Inhibitors, & Enzymes
-
ImmunogenCOX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL
-
SpecificityCOX10 antibody was raised against the middle region of COX10
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COX10 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCOX10-DT, COX10
-
Short nameRabbit COX10 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal COX10 antibody raised against the middle region of COX10
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nameCOX10 divergent transcript
-
Synonyms gene
-
Synonyms gene name
- COX10 antisense RNA (non-protein coding)
- COX10 antisense RNA 1 (non-protein coding)
- COX10 antisense RNA 1
-
Locus
-
Discovery year2010-08-19
-
Entrez gene record
-
Classification
- Divergent transcripts
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namecytochrome c oxidase assembly factor heme A:farnesyltransferase COX10
-
Synonyms gene name
- COX10 homolog, cytochrome c oxidase assembly protein, heme A: farnesyltransferase (yeast)
- cytochrome c oxidase assembly homolog 10 (yeast)
- COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1996-10-31
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Mitochondrial respiratory chain complex assembly factors
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data