Rabbit Complement C4b antibody

  • Catalog number
    70R-5742
  • Price
    Please ask
  • Size
    50 ug
  • Applications
    WB
  • Product Type
    Primary Antibodies
  • Product Subtype
    Purified Polyclonal Antibodies
  • Research Area
    Immunology
  • Immunogen
    Complement C4b antibody was raised using a synthetic peptide corresponding to a region with amino acids QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
  • Specificity
    NA
  • Cross Reactivity
    Human
  • Clone
    NA
  • Concentration
    1 mg/ml
  • Form Buffer
    Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4B antibody in PBS
  • Storage
    Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
  • Shipping Info
    Blue Ice
  • Properties
    If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
  • Latin name
    Oryctolagus cuniculus
  • French translation
    anticorps
  • Gene target
    Complement   C4b  
  • Gene symbol
    C4B, CR1L, C4A
  • Short name
    Rabbit Complement C4b antibody
  • Technique
    Antibody, Rabbit, antibodies against human proteins, antibodies for
  • Host
    Rabbit, Rabbits
  • Isotype
    NA
  • Alternative name
    Rabbit polyclonal Complement C4b antibody
  • Alternative technique
    antibodies, rabbit-anti
  • Alternative to gene target
    complement component 4B (Chido blood group), C4B_2 and C4B1 and C4B12 and C4B2 and C4B3 and C4B5 and C4BD and C4F and CH and CO4 and CPAMD3, C4B and IDBG-301132 and ENSG00000224389 and 100293534,721, carbohydrate binding, Extracellular
Gene info
  • Identity
  • Gene
    C4B
  • Long gene name
    complement C4B (Chido blood group)
  • Synonyms gene name
    • complement component 4B
    • complement component 4B (Chido blood group)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-06-22
  • Entrez gene record
    721
  • RefSeq identity
  • Classification
    • C3 and PZP like, alpha-2-macroglobulin domain containing
    • Blood group antigens
    • Complement system activation components
  • VEGA ID
  • Locus Specific Databases
Gene info
  • Identity
  • Gene
  • Long gene name
    complement C3b/C4b receptor 1 like
  • Synonyms gene name
    • complement component (3b/4b) receptor 1-like
  • GenBank acession
  • Locus
  • Discovery year
    1989-04-24
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Sushi domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee