Rabbit CNTNAP1 antibody
-
Catalog number70R-6158
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCNTNAP1 antibody was raised using the N terminal of CNTNAP1 corresponding to a region with amino acids LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS
-
SpecificityCNTNAP1 antibody was raised against the N terminal of CNTNAP1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNTNAP1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCNTNAP1
-
Short nameRabbit CNTNAP1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CNTNAP1 antibody raised against the N terminal of CNTNAP1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcontactin associated protein 1, CASPR and CNTNAP and NRXN4 and P190, CNTNAP1 and IDBG-51437 and ENSG00000108797 and 8506, SH3 domain binding, Plasma membranes, Cntnap1 and IDBG-211921 and ENSMUSG00000017167 and 53321, CNTNAP1 and IDBG-640336 and ENSBTAG00000019097 and 540997
-
Gene info
-
Identity
-
Gene
-
Long gene namecontactin associated protein 1
-
Synonyms gene
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1998-10-14
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Contactin associated protein family
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data