Rabbit CMTM8 antibody

• Catalog number
  70R-6363
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
• Specificity
  CMTM8 antibody was raised against the middle region of CMTM8
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CMTM8 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  CMTM8  
• Gene symbol
  CMTM8
• Short name
  Rabbit CMTM8 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal CMTM8 antibody raised against the middle region of CMTM8
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  CKLF-like MARVEL transmembrane domain containing 8, CMTM8 and IDBG-23679 and ENSG00000170293 and 152189, cytokine activity, nuclei, Cmtm8 and IDBG-203701 and ENSMUSG00000041012 and 70031, CMTM8 and IDBG-644105 and ENSBTAG00000001710 and 533671

Gene info

• Identity
  HGNC:19179
• Gene
  CMTM8
• Long gene name
  CKLF like MARVEL transmembrane domain containing 8
• Synonyms gene
  • CKLFSF8
• Synonyms gene name
  • chemokine-like factor super family 8
  • chemokine-like factor superfamily 8
  • CKLF-like MARVEL transmembrane domain containing 8
• GenBank acession
  • AF474370
• Locus
  3p22.3
• Discovery year
  2002-09-10
• Entrez gene record
  152189
• RefSeq identity
  • NM_178868
• Classification
  • CKLF like MARVEL transmembrane domain containing
• VEGA ID
  OTTHUMG00000130753

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products