Rabbit CMTM8 antibody
-
Catalog number70R-6363
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
-
SpecificityCMTM8 antibody was raised against the middle region of CMTM8
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CMTM8 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCMTM8
-
Short nameRabbit CMTM8 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CMTM8 antibody raised against the middle region of CMTM8
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCKLF-like MARVEL transmembrane domain containing 8, CMTM8 and IDBG-23679 and ENSG00000170293 and 152189, cytokine activity, nuclei, Cmtm8 and IDBG-203701 and ENSMUSG00000041012 and 70031, CMTM8 and IDBG-644105 and ENSBTAG00000001710 and 533671
-
Gene info
-
Identity
-
Gene
-
Long gene nameCKLF like MARVEL transmembrane domain containing 8
-
Synonyms gene
-
Synonyms gene name
- chemokine-like factor super family 8
- chemokine-like factor superfamily 8
- CKLF-like MARVEL transmembrane domain containing 8
-
GenBank acession
-
Locus
-
Discovery year2002-09-10
-
Entrez gene record
-
RefSeq identity
-
Classification
- CKLF like MARVEL transmembrane domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data