Rabbit CLPTM1L antibody
-
Catalog number70R-7327
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCLPTM1L antibody was raised using the middle region of CLPTM1L corresponding to a region with amino acids KAFTYKAFNTFIDDVFAFIITMPTSHRLACFRDDVVFLVYLYQRWLYPVD
-
SpecificityCLPTM1L antibody was raised against the middle region of CLPTM1L
-
Cross ReactivityHuman, Mouse, Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLPTM1L antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCLPTM1L
-
Short nameRabbit CLPTM1L antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CLPTM1L antibody raised against the middle region of CLPTM1L
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetCLPTM1-like, CLPTM1L and IDBG-11103 and ENSG00000049656 and 81037, Plasma membranes, Clptm1l and IDBG-165816 and ENSMUSG00000021610 and 218335, CLPTM1L and IDBG-632161 and ENSBTAG00000001329 and 506200
-
Gene info
-
Identity
-
Gene
-
Long gene nameCLPTM1 like
-
Synonyms gene name
- CLPTM1-like
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2006-08-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data