Rabbit CLEC4M antibody
-
Catalog number70R-6089
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenCLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
-
SpecificityCLEC4M antibody was raised against the n terminal of CLEC4M
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLEC4M antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCLEC4M
-
Short nameRabbit CLEC4M antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CLEC4M antibody raised against the n terminal of CLEC4M
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetC-type lectin domain family 4, member M, CD209L and CD299 and DC-SIGN2 and DC-SIGNR and DCSIGNR and HP10347 and L-SIGN and LSIGN, CLEC4M and IDBG-23635 and ENSG00000104938 and 10332, metal ion binding, Extracellular
-
Gene info
-
Identity
-
Gene
-
Long gene nameC-type lectin domain family 4 member M
-
Synonyms gene
-
Synonyms gene name
- CD299 antigen
- C-type lectin domain family 4, member M
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-09-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data