Rabbit CHRNA4 antibody
-
Catalog number70R-5185
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaNeuroscience
-
ImmunogenCHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT
-
SpecificityCHRNA4 antibody was raised against the N terminal of CHRNA4
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CHRNA4 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCHRNA4
-
Short nameRabbit CHRNA4 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CHRNA4 antibody raised against the N terminal of CHRNA4
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcholinergic receptor, nicotinic, alpha 4 (neuronal), BFNC and EBN and EBN1 and NACHR and NACHRA4 and NACRA4, CHRNA4 and IDBG-86002 and ENSG00000101204 and 102723788,1137, acetylcholine binding, Cell surfaces, Chrna4 and IDBG-213951 and ENSMUSG00000027577 and 11438, BT.35525 and IDBG-640656 and ENSBTAG00000017198 and 537251
-
Gene info
-
Identity
-
Gene
-
Long gene namecholinergic receptor nicotinic alpha 4 subunit
-
Synonyms gene
-
Synonyms gene name
- cholinergic receptor, nicotinic, alpha polypeptide 4
- cholinergic receptor, nicotinic, alpha 4 (neuronal)
- cholinergic receptor, nicotinic alpha 4
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1990-05-11
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Cholinergic receptors nicotinic subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data